1.87 Rating by WebsiteTestingTool.com

modernfamilynightlysweepstakes.com was registered 2 years 2 months ago. It is a domain having .com extension. It is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently, modernfamilynightlysweepstakes.com is SAFE to browse.

Visit Website

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable
Alexa BackLinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Very Poor
WOT Privacy: Very Poor
WOT Child Safety: Very Poor

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: Not Applicable
PageSpeed Score: 87 ON 100
Domain Authority: ON 100
DMOZ Listing: No

Web Server Information

Hosted IP Address:

Hosted Country:

United States US

Location Latitude:


Location Longitude:


Social Engagement

Facebook Shares: 53
Facebook Likes: 20
Facebook Comments: 15
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable
Google+: Not Applicable

Page Resources Breakdown

Homepage Links Analysis

Come Together and Go Gourmet the Modern Family Nightly Way! Sweepstakes
Enter for a chance to come together and go gourmet the Modern Family Nightly way!

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 4
Google Adsense: Not Applicable Google Analytics: UA-31504323-12

Backlink History Chart

Referring Domains Discovery Chart

HTTP Header Analysis

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: Microsoft-IIS/8.5
Vary: Accept-Encoding
X-AspNet-Version: 4.0.30319
Cache-Control: private
Content-Type: text/html; charset=utf-8
Content-Encoding: gzip
Date: Mon, 28 Dec 2015 09:02:04 GMT
X-Powered-By: ASP.NET
Content-Length: 1625

Domain Information

Domain Registrar: MARKMONITOR INC.
Registration Date: 2014-08-08 2 years 2 months 1 week ago
Last Modified: 2015-05-19 1 year 5 months 1 week ago
Expiration Date: 2016-08-08 2 months 2 weeks 1 day ago

Domain Nameserver Information

Host IP Address Country
dns1.stabletransit.com United States United States
dns2.stabletransit.com United States United States

DNS Record Analysis

Host Type TTL Extra
modernfamilynightlysweepstakes.com A 3600 IP:
modernfamilynightlysweepstakes.com NS 3600 Target: dns1.stabletransit.com
modernfamilynightlysweepstakes.com NS 3600 Target: dns2.stabletransit.com
modernfamilynightlysweepstakes.com SOA 3600 MNAME: dns1.stabletransit.com
RNAME: ipadmin.stabletransit.com
Serial: 1437593085
Refresh: 3600
Retry: 300
Expire: 1814400
modernfamilynightlysweepstakes.com MX 3600 Priority: 20
Target: mx2.emailsrvr.com
modernfamilynightlysweepstakes.com MX 3600 Priority: 10
Target: mx1.emailsrvr.com
modernfamilynightlysweepstakes.com TXT 3600 TXT: v=spf1 include:mailgun.org ~all

Similarly Ranked Websites


- google.com

Search the world's information, including webpages, images, videos and more. Google has many special features to help you find exactly what you're looking for.

  1   $ 11,147,271,840.00


- youtube.com

Enjoy the videos and music you love, upload original content, and share it all with friends, family, and the world on YouTube.

  2   $ 5,573,635,920.00

Facebook - Log In or Sign Up

- facebook.com

Create an account or log into Facebook. Connect with friends, family and other people you know. Share photos and videos, send messages and get updates.

  3   $ 3,715,757,280.00


- yahoo.com

News, email and search are just the beginning. Discover more every day. Find your yodel.

  5   $ 2,229,454,800.00

Amazon.com: Online Shopping for Electronics, Apparel, Computers,...

- amazon.com

Online shopping from the earth's biggest selection of books, magazines, music, DVDs, videos, electronics, computers, software, apparel & accessories, shoes, jewelry, tools &...

  6   $ 1,857,878,640.00

Alexa Traffic Rank

Alexa Search Engine Traffic

Full WHOIS Lookup

Domain Name: modernfamilynightlysweepstakes.com
Registry Domain
ID: 1870313490_DOMAIN_COM-VRSN
Registrar WHOIS Server:
Registrar URL:
Updated Date:
Creation Date:
Registrar Registration Expiration Date:
Registrar: MarkMonitor,
Registrar IANA ID: 292
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientUpdateProhibited
Domain Status:
Status: clientDeleteProhibited
Registrant ID:
Registrant Name: Intellectual Property
Registrant Organization: Twentieth Century Fox Film
Registrant Street: P.O. Box 900,
Registrant City:
Beverly Hills
Registrant State/Province: CA
Registrant Postal
Code: 90213-0900
Registrant Country: US
Registrant Phone:
Registrant Phone Ext:
Registrant Fax Ext:
Registrant Email:
Registry Admin ID:
Admin Name: Intellectual
Property Department
Admin Organization: Twentieth Century Fox Film
Admin Street: P.O. Box 900,
Admin City: Beverly
Admin State/Province: CA
Admin Postal Code:
Admin Country: US
Admin Phone:
Admin Phone Ext:
Admin Fax:
Admin Fax
Admin Email: domains@fox.com
Registry Tech ID:
Name: Intellectual Property Department
Tech Organization:
Twentieth Century Fox Film Corporation
Tech Street: P.O. Box
Tech City: Beverly Hills
Tech State/Province: CA
Postal Code: 90213-0900
Tech Country: US
Tech Phone:
Tech Phone Ext:
Tech Fax:
Tech Fax
Tech Email: domains@fox.com
Name Server:
Name Server:
DNSSEC: unsigned
Data Problem Reporting System: http://wdprs.internic.net/
>>> Last
update of WHOIS database: 2015-12-28T01:02:12-0800